title
Sossage inna bun! Dear old sossage inna BUN!
Watching Supernatural. Why does nobody tell me how good these things are until Season 3?
Dum, adub-a-de, dub-a-de dum dum dum.
@neilford: The Lies of Locke Lamora & its sequel
I is in your soshal netwerks, rerootin yr pawadimes.
Fly, My pretties! Fly into the wide world!
Regretting the last beer. Working on Stuff. Astoundingly: This.
Fun.
Going to the Pembury Tavern. As foretold in the prophecy.
mmer. Demolish wall. Step Forward. Bang Nose On Wall. Find Right Hammer. Demolish Wall. Step Forward. Bang Nose On Wall. Find Right Ha
@littleredboat: Eventually all parcels will be equipped with twitter accounts.
...and I missed the first wave for BarcampLondon3. Hate the universe. Now: Tea.
Making sure that updating twitter now updates both facebook and Aquarionics.com. APIs are neat.
doing science and I'm still alive.
Do not try to out-sarcasm reality: You will fail. It will hurt. The cake is a lie.
@bentbacktulips Or a larger glass
Knowledge gets logarithmically more dangerous
Primarily, programming potential provisioning paradigms, possibly predicting prospective people's path patterns.
@resiak: Close, but too dense. Besides, these were really nice sausages. Walthamstow Farmer's Market apparently has a use...
TFINow
Thursday is good, I can work with Thursday. Nearly Friday, got the post Tuesday (http://icanhaz.com/weekend) slump over. Thursday's good.
Hmm. It's Pub Standards tonight, isn't it? Oh, what to do, what to do...
attempting to balance effects of good lunch with coffee and sugar
At a slightly scattered pub standards
Distressed by how quickly it's gotten dark in the mornings.
doom
Why can't fire alarms be on nice, warm days?
It's a Harrisons for lunch day. London++
Attempting to deal with having lost his wallet. Why do they only print the Lost phone number on the card you've just lost?
Could song be an alibi? A lyric replacement for falling in love. But now that the well is dry, I can't understand what I've been singing of.
Discovering Aquarionics' twitter integration doesn't like URL-only messages and wishing he had someone else to blame.
http://tinyurl.com/3y6ff9
Also wanting a portal gun.
Watching the movie Network
Work It Harder, Make It Better, Do It Faster, Makes Us stronger, More Than Ever, Hour After, Our Work Is Never Over
At De Hems
Attempting to down out screams of the innocent with Belle and Sebastian
Good Morning Twitter! Hello world! Hello birds! hello sky!
rassinfassinsuprisefeaturesmuckingwithmyschedulefassinrickrastardlywannamedal
Milestone reached! Party! Now, next milestone...
I'm doing science, and I'm still alive.
@simonw: You may get an XML error back in about ten minutes, Twitter IM appears to be broken
@natbat: Yes
Working the weekend. :-(
Have tea. Destruction of the universe postponed until after lunch.
Astoundingly, the destruction of the universe has not made it easier to get to work, unless I dreamed the first bit. That would be a shame.
living in a yellow submarine, a yellow submarine, a yellow submarine.
WORK YOU STUPID HUNK OF SILICON
Still Still at work
Still at work.
London peeps: Acorn House is doing cottage pie. Eat it and die happy.
Left the office 2:30. Back 8:50. Pretty sure today must be Thursday.  Possibly also January. Can I haz christmas?
Neat, twitterim appears to be back alive
Launching www.trutap.com into open beta.
kapowaz: Probably not, but you might get a way with Wii Bowling.
Is astounded that he managed to make mod_rewrite work first time
Listening to Georgette Plays A Goth far too much.
I'm not here right now
I R Zombie Aquarion. This R Zombie Day.
@smin: You should have dropped in, beer makes heads less fluffy.
Bzank! Krack! CLABOOM! For I am Batman, defeating the bugs, defending the innocent, writing the wrongs. Righting. I mean Righting.
Posting from the future with my iPhone revision 4. Rocket cars now commonplace, leading to a world salad shortage.
Cut, code, commit, checkout, test, code, commit, checkout, test, code, commit, test, merge, new ticket, cut, code, commit
Working
Right time. Right film. Wrong cinema. Epic fail.
Seen stardust. Want an airship
Black coffee. Launch later.
Home from work. Mblergsgvh
@mollydotcom: During, obviously. I mean, who uses HTML? PDF is the future of the web.
In the office early this morning to do some profiling while it's quiet *yawn*
The naming of hosts is a difficult matter, and isn't just one of your everyday names. You may think at first I'm as mad as a hatter, whe ...
Not buying an iPhone. Resisting. Resitting. RESISTING.
Succeeded in not buying an iPhone.\n\nHave bought a new laptop instead.\n\nNet result: Failure.
Hello Cambridge, long time no see
Monday morning. Yay.
Preparing for big office party of DOOOOOM
There is a receipt two feet long behind the CTO. I have a hangover. The party was fun.
Bacon
Am on (another) train to Cambridge. It appears to be ticking.
Weeeeeeeeee *crash* Deadaquarion is deeeeeead
Wondering who thought putting an entire XML document in an assoc array just go get at element[0] was a good idea, and plotting the DOOM.
Ah... coffee. Black as pitch, sweet as sin, covered in bees
Have become gunge factory, to be hired by Noel Edmunds in due course
Code monkey not say it out loud, Code monkey not crazy.
At work, quiet office, music on, hot chocolate to my right. Today is going to go downhill from here...
Drinking turkish delight hot chocolate
On the other hand, at least it's friday
Heanding to the pub, as is traditional
Judging a hair growing contest
Bouncing, bouncing on the ceiling...
Coffee is obviously a good idea, and I can see no downsides to it.
Making schoolboy errors, should have caught that one before it went in.
Kings Cross is closed due to overcrowding. antifun
Thinking about pirates.
Joining the Dopplr Collectiv.
Morning
Playing buzzword bingo in product meeting
It's the final countdown, de-de-de-do, de-de de de do
Returning from pub lunch. Go Go Gadget Productivity!
Am now on holiday
Heading back to Paddoxk Wood for Christmas
Wishin I'd brought my camera, Kent's so peaceful in the frosty morning
Going christmas shopping. This may be interesting
Hurrah! A train! I may not freeze to death! Unless I miss the train due to twittering about the train, which would be silly.
@Xalior: Dance? In the fabled words of the hit song from Genesis, No.
Missed connection train. Stuck at station for half hour. Frost less peaceful when settling on me.
Every year I say 'next year: earlier', but that wasn't too bad. Apart from the people.
Fixing grandparent's technology. As is traditional
Consuming the flesh of the pheasantry
@kapowaz: It was a triumph.
Back in London. Christmas now officially over
Learning how to play backgammon
Playing games and waiting for tomorrow
The girl-shaped love drug messes with my mind.
Before the networks die, Happy New Year
Despite spending new year's eve playing a chess varient called Penultima, I maintain my not-a-geek status
Am now awake. Way to screw up sleep cycles.
Going for a hair of the dog who bit most of my twitter stalkees. HNY
Astoundingly, it works in IE. Perfectly. I must have gone to sleep and am dreaming.
Checking new design aspects in IE before I go to sleep. 4am.
Back at work, first since mid-december. Too much stuff. Not enough tea. Can fix one of these right now.
Huffing upon this ice-lolly selling cart.
doin' the div-block tango
@resiak, @chrisnicolson : Bananaphone!
Right. I give up, give in, give left, give right, do the hokey cokey, and go to the pub.
Pemburyfided
Annoyed that my current is blocking new flat by inattention
Cursing APIs for not giving me all the information I want/need
@resiak: Whatever that was, Twitter didn't want to divulge its orientation.
@resiak: If you hold your T upside down, you'll spill it.
@smin: Seems to be holding up...
considers crushing the unworthy beneath a large pile of hopes and disappointments made physical. Happy Friday.
Here comes Bod.
nO! IT's AlL GoINg PErfeCtLY, WhY DO yOU AsK?
I have the keys to my new flat.
Have impulse-bought a toaster. Living on the wild side today
New flat has no internet until friday. Woe
@schwuk Merged into a gmail account mirrored on an imap server, stuff from each domain gets labelled as the domain
@resiak: I mirror it by downloading it with IMAP. It's entirely so I have a copy of all my mail for if gmail goes foom.
Having circular logic problems with the TV Licensing office
Exceeding my alcohol allowance
Buddha bag
Feeling suprisingly good for two hours sleep.
Having second thoughts about not moving back to cambridge
...have punted my looked-forward-to week off for a week. Bah.
Yearly review, one hour. Go Go Gadget Productivity
Admiring @Doseybat's dedication to duty
X-UA-Compatible: IE=8;FF=3;OtherUA=4 \n X-IE8-Kitten-Killing-Mode: Activate
The internet has been delivered. It comes in a big red box.
@schwuk I find that in conjunction with the "Add anything I star in gmail as a todo task" it's very good indeed
In a bar decorated like my great aunt's living room
Regretting the last four White Russians last night.
Taking over the trutap blog. Mwa ha ha ha ha
In pub with the special he'll
Happy Monday, Internet
Planing a future with party rings in it.
Train to cambridge
Measuring things WITH LASERS
Reclaiming my pistols, holster & badge.
A famous person wears the same size waterskis as me, she's got three cars as many years i've lived in this city
Back in the special hell, having flooded Carcassonne.
Dead aquarion will rise tomorrow needing brainz
Going to worship at the temple of the goddess Ikea
Realising why ikea  bills itself as a family store. It's not designed for single people
Ending my week off with reluctance
Crushing the world beneath the weight of its own despair. And hacking Zend Framework. Which is kind of the same thing.
Listening to the protest outside the Congolese embassy, how can you be out of tune to a protest chant?
Hah! Take that, arbitrary representation of technicalities! I defeat your stupidity with LOGIC! DO YOU HEAR ME? LOGIC! LOGIC!! LOOOOOOOOGIC!
Plotting the doom of the masses
Starting the process of working out what to do at Brighton Bar Camp. Hmm. BBC. That could get complicated.
I'm doing Science, and I'm Still Alive
All aboard the caffeine mainline...
Trying to work out what to do for trutap's internal hack day
Up, Up, Down, Down, Left, Right, Left, Right, B, A, Select, Start.
Scones ftw
Attempting to force his brain into gear with the aid of speedy music. last.fm/aquarion
Discussing pig-based economics
Kicking off Project Roger. Three hour meetings are wonderful and I encourage them all the time!
All the ducks are swimming in the water, faldaraldraldo.
What the hell am I doing here? I don't belong here.
Confused Aquarion is Confused.
I have an crocodile T-shirt from my brother. Am now officially a snappy dresser.
Doing things is what I like to do
@gruber Works perfectly here - I use it for dev  - but I'd heavily recommend using MacFusion as the GUI http://tinyurl.com/25us47
I can seeeeeee you
Morning world
Feeling all virtuous by doing Cookery Stuff, now going to the pub
Surprise buttsecks!
Offering an explanation for last night's message...
@alidriver I find Twitterific works a lot better
@abigailb In the end, what I went in for. Which was cuddly kittens.
Okay, do not let me into Hamley's with a credit card. It is a Bad Place
At the London PHP Conference. Not massively impressed, and the wifi sucks. Also, apparently I should be using a versioning system, amazingly
The best thing about Monday mornings is... ... ... ... ... don't rush me, I'm still thinking.
Ergonomic keyboard now makes my hands hurt. SIgh.
@doseybat Think of them less as spots and more as "impending lamp-post detection systems"
Embiggening my mental-word-list-thing with enhanced cromulantcy
@doseybat & @abigailb I don't have 50 win, I can give you 100 win and 50 fail when the shipment of fail arrives.
Sharing the Hello Kitty tarot with the world: http://www.aeclectic.net/tarot/hello/
@abigailb I have _a_ Will Smith's phone number. Unfortunately I believe he's an insurance salesman in birmingham
Considering a zombie movie where the virus propagates first by researchers eating the samples due to extreme hunger, and thereafter by brain
@abigailb I believe he has a kitten, but I'm sure he can bleed.
@resiak Thanks :) We're still looking for people.
@schwuk It always scares me when people link to trutap news :)
Heading to the pub. Tube astoundingly busy
Many fails. Many, many fails. So much fail the shipment failed
Experimenting with fifo office theory
@doseybat Then the obvious reaction is not to ignore them, and to explain to them the complex principles of omnomnomnom.com
@doseybat they are coloured purple to indicate they are tasty and you should eat them.
Code monkey break twitter :( Code monkey swap feeCoffeeCof for Tab & Mountain Dew
@abigailb Please to be holding a cup under your computer's serial port in exactly 5.245 minutes.
@ewt Kittens: http://tinyurl.com/qcny5
Mildly worried that I still don't have a BarCampBrighton idea yet
Going nowhere. Yay days off.
I should take holiday more often, it appears to do good things for my brain. Who'd have thought it? Back at work today, though :-(
@molly: Because oftentimes manipulation is hiding under the generosity table.
Research. This may look superficially like joining Orkut. Anyone watching this got an Orkut account?
@kianryan: Luck
kian: There's specs and drafts, and Orkut will release it for Real People RSN(tm) at V0.7. MySpace have implemented 0.5 for beta. Unfinished
Writing roughly the same report on OpenSocial as I did four months ago. Nice idea, talk to me when people can use it.
Enough with this madness, tonight we dine in hackney!
It's ten to seven. Do _you_ know where _your_ brain is?
Dreaming the impossible dream. Then specifying it in detail with breakdowns, time estimates and possible pit-falls. Existance is so exciting
Have been sent missive from muse. Will miss B5 due to Plot Development.
Squash Aquarion is made of concentrate. He will concentrate, concentrate, and not be distracted by the shiny thing that is... so... shiny...
Apparently Planet Trutap drinks too much coffee. The coffee machine repair place have asked if we're a cafe :(
I am at work. Early. For Hack Day. I suspect I have my priorities shifted.
Alas and woe, for the blown fuse in the kitchen means I have to walk THREE PACES to the kettle with a teabag :( How am I going to cope?
Woe and alas, and other sources of drama, for verily am I back at work and verily art there more things to do before the close of the day :(
On a train to cambridge for larp
Attempting to be interested in writing technical specifications, my brain is rebelling against this and wishes to hide in a corner somewhere
Tea! *recovers over-steeping tea*
@doseybat or, preferably, a complete bed with multiple duvets?
Passing on the true meaning of easter: http://tinyurl.com/38jwgy
@ahruman Fantastic, Just upgraded :)
@ahruman Also, there should be a button for Reply, rather than having to look up people's usernames manually
Vic line suspended due to sqishy human
Refers the enigmatic Mister Ellis to http://oo5.whatiminto.com
@schwuk: TBH, I prefered it when I only saw your blog entries once :)
@schwuk: Actually, I meant once in my feedreader, but your problems do appear to have exacerbated the problem a little bit :)
JoCo gig is now Table Seating. Do I know anyone else going to it?
To @oscarhocklee & @kianryan See @zefrank's twitter stream
It is time to take a stand in the colour wars, I have joined @zefrank on the Blue Team
Not going to Arty Games Evening due to fail, since I have to write stuff for LARPy games weekend
@abigailb: GIFs will happen once it's dry and more obvious
Back to being a redhead for a while.
@doseybat @abigailb http://www.flickr.com/photos/aquarion/2346653578/
Bus to E17, train to Liverpool St, Tube to Tower Hill, DLR to Canary Wharf. I'm an an Oyster advert today. Not accepted on the coach, though
Heading to Hadleigh
Having used my o-card all the way up to CW, I spent an hour waiting for a non-TFL bus that never arrived. Last time I try to leave London
Heading to Joco gig. See people there
@roryparle which corner?
@smin sadly not. On the other hand, I'm intending to stay (the hell) away from the Tequila
The @joco gig ends up being at the place I got horrendusly drunk at an EM christmas party
Heading off to camp and trade with the forces of good and evil. All else is fine, it's the camping I'm not sure about...
Between planned closures and signal FAIL I should be less surprised that this train may or may not stop where I need it to, depending wh ...
Am camping in the snow. Am massivly hardcore larper. Also: COLD.
On a train back to London, stopping at every tinpot republic between. No longer being snowed on - a noted bonus. Camping is hard. Also cold.
@oscarhocklee I'm not going to be in London for a few hours yet, unfortunately
Oscarhocklee Yeah, I guessed. I could get from London to Berlin by train in the time it's going to take to get from Birmingham to London.
I am back at work. Pluses: Central heating, tea, internet. Minuses: Back to being me again, Back at work
The building is out of water. Conspiracy to keep me from full levels of civilization being maintained.
@simonw There's a pref option to make the window auto-scroll on new tweets again, but yeah, the new way's not great
Is booked for barcamplondon4: http://tinyurl.com/33q7cc
@secretlondon it's a geek "unconference"-style conference, everyone who attends also presents, see http://www.barcamp.org/ for details [...]
Still attempting to hire web-devs, and now looking for QA peeps & sysadmins too.
@secretlondon I saw that, and don't subscribe to @nk899. I think it's a preference setty thingy.
@ahruman Because it is technology and therefore doesn't work with everything, because that would make life too easy.
Have finally watched the Sky Hogfather Adaptation. Believe it not to be awful, but a little heavy-handed in places. tCOM tomorrow.
Epic awareness fail, has missed party
Reasonably epic morning fail. More Belgariad than Lord of the Rings, in epicness
@kianryan To be honest, yes, there is a great deal of fail in my life right now, thanks.
kianryan: Unless they actually mean the silent majority. The average, man on the street type, who considers Eastenders the pinnacle of drama
kian: AHa, I never groked jQuery enough, so tend to stay with Prototype, which I like. Currently playing with Dojo, which makes me happy.
@kianryan Growing on hell?
+++OUT OF TEA ERROR+++  +++REDO FROM ALARM CLOCK+++
I shall tell the police, I want that french horn back. I miss its music more and more more. Without that horn I'm feeling sad and so forlorn
@oscarhocklee: Coming soon!
Decides that 54.94 is close enough to 55 for Sixtytoone and considers an actual release at some point soonish.
@schwuk I've been running between 500 & 1000 unread since just before easter...
Once upon a time there was small yellow elephant, who grew into a large yellow elephant. Then it found it felt better about itself. The End.
@ahruman & @abigailb: This is possibly so, also writing within a restrictive form remains a useful exercise and entertainment for the bored.
@secretlondon I almost entirely fail to see how that final result would be incompatible with a more utopian ideal for the development world.
Wondering how long I can keep making each tweet also a twoosh and if that defeats the point of a medium I can update almost with no thought.
@secretlondon OTOH, could argue that if we taught people how computers work, instead of how icons work, they'd be fewer Tech Support stories
Considering destruction of all human and virtual life in a fiery explosion of death and flame merely to stop having to write specifications.
Now at six of the clock, and the time has come to repair to yonder hostelry for entertainments and fine ale, for tonight we dine in Hackney!
Drat it, @oscarhocklee, you have entirely spoilt the final section of the epic story of love and betrayal of the yellow elephant in 7 parts.
Barbarians. Do you not see the wonder of deep culture when it is placed in your twitter feed? How the elephant is a metaphor for everything?
Eventually, I have returned from the place marked as "Yonder Hostelry", though I suppose it should now be referred to as "Thither Hostelry".
@chrisnicolson It is worth noting that it is entirely possible to get Snapshots - via the cog icon - to set a cookie never to be seen again.
Have returned from the wide outside world, which had lunch and hummus in it, both at the same time. Of course, the transport network failed.
Observing that the desire to craft messages more carefully within form is limiting my ability to flood Twitter with randomness. For the win.
"My Lady?" "Jenkins, This must not not be" "Indeed, this will not be" "You do not appear to be leaving, sir" "No, My lady. This is my room."
Wondering why BST has screwed me over quite this badly this time, when previously I have quite happily ignored it and carried on regardless.
Considering the logic of going home instead of going out drinking for the fourth night running. I believe that may result in Broken Aquarion
@secretlondon Oh, I didn't realise there was a London.pm meeting. Nah, I'm going to a web-geeks drink-fest
Have returned from superstandard substandards involving beer, stickers, beer, drama, vodka, vodka, breakfast, and new people of much yayness
Coming to the likely conclusion that I may have drunk too much at some point last night. Considering legal action against the hammer-gnomes.
@schwuk Possibly. I did go for the groundbreaking approach of researching the horses and the form, and then choosing one entirely at random.
Starting a new tradition, the same as everyone else's old tradition: Am currently making my annual donation to the british betting industry.
Today contained Girl Genius, Steak, Doctor Who, 100 words of story and nearly on to the plot, and geekery. Making a note here: Huge success.
Incidentally, my great experiment into tradition failed, although I was impressed that the net-betting office could fleece me though paypal.
Considering exactly how surprised I should be that upgrading the framework a point release appears to result in the breakage of the universe
@chrisnicolson .. Yes, yes it would, wouldn't it. That would be why I don't have any hot water in my house in the morning, now... Fucksocks.
Morning has broken, like the first morning. Telephone spoken, number was wrong. Praise for the new tea, made from the tea-bag. Now, to work!
Vaguely amused at how many of his social circles have suddenly discovered the amazing wonder and joy of twitter and microbloggery in general
@kianryan Grouping tickboxes, radiobuttons, areas of forms. Think "Frame" in the Microsoft interface designer stuff. It's occasionally vital
@kianryan Google.com appears to work absolutely find from where I am accessing the internet from, maybe your interweb connection is buggered
Defeating the forces of reality with the awesome and inexplicable power of my brain, powered by tea. Mere existence cannot but fall beneath.
Attempting to decide between @acornlunch and subway. Terrible is the plight of the london worker plagued with so much choice in lunch places
@emmapersky Possibly they're following the public feed, and have ALL THE TIME IN THE WORLD. Incidentally, I still have your last.fm stickers
@resiak After a series of comments of that nature I have now discovered the password for the account and reset the colourscheme to suck less
@kianryan: It doesn't actually twitter, it emails, and I feed it to twitter for the benefit of people who want to know, like my office here.
@kianryan: Do not give in to the lure of the Krispy Kremes, for if you do so than your soul may eventually be forfeit. Plus: death by sugar.
My tea, without me, is useless. Before my tea, I am useless. I will drink my tea hot. I will add milk to my tea and drink it. This is my tea
@mpettitt Which LOTRO server did you end up on?
Attempting to rearrange elements of last week's absolute socking disaster into a form which I can recover from without pain. Now: Go to work
will destroy you and all you stand for, for this low, low price of five installments of $49.99. We accept visa, mastercard, paypal and souls
Okay, so the convention of putting L colon Location doesn't actually do anything on the back end yet, but might be adopted for placemarking.
Attempting an experiment with twitter to see if the L API thing affects my Tweet140 HiScore and thus entirely invalides the attempt L:trutap
@secretlondon Not officially, but www.tweet140,com - if you sign up - tracks you and scores for posts of exactly 140 characters - "a Twoosh"
@secretlondon Yes, My twitter client and the one on the main twitter.com website both give you a countdown on characters that you have used.
Observing that that's a dozen tweets this morning mentioning how people are preparing for GTA 4. That's exactly twelve more than Halo 3 got.
@catashton: I've no idea, I look forwards - one day - to discovering this utopian state you allude to where my money is actually still mine.
@catashton: Fah. I still haven't yet finished paying off the last time I was a student, without going so far as to wish to become one again.
Woe, I am merely just past the 600 mark of twitter messages, far behind the skills of my peers. Can I ever reach their heights of timewaste?
@kianryan I would recommend not doing that, I hear that it may cause hearing loss in the more extreme circumstances, and loss of facilities.
@kianryan:  It may interest you to know that you can set a value in about:config to disable version checking, extensions.checkCompatibility.
@emmapersky The solution to fading on an alternate Thursday is obvious, come forth to the pub where we have an anti-fading agent called beer
@kianryan no relationship at all. Released at similar times with no knowledge of each other
At #pubstandards, avoiding interpub twitterfication. Also, have given up on tweet140
Last night I dreamed I got elected mayor of   london.
@mpettitt Okay, so I missed your reply a week ago, I am also on eldar, but I'd guess your trial's expired by now?
@secretlondon ..mosaic experience? Wow. Haven't seen that for a while. Time to visit the out-moded browser archive sites and refresh memory?
On my way to maelstrom gathering in Camden
Monday monday, can't trust that day. Monday monday, sometimes it just turns out that way.
Also, apparently  taking the net connection away from MacFusion makes any program using MF's sftp drives cry, demand mommy then crash badly.
Terrible times! Internet was down in Planet Trutap for an entire hour! An hour without internet, what have I missed, WHAT HAVE I MISSED?!!!!
@ruthi 1) We would not try such a thing, we couldn't be that desperate. 2) We were internet deprived, not mad. 3) Cats would not stay still.
The internet has returned to the trutap offices. Reports that we ended up forced to take polaroids of cats and write captions are unfounded.
@kianryan You're in london?
Finding http://code.flickr.com to be an interesting exercise in semi-open development methods.
Tube failure, overcrowding at KX. Almost as if they should have spent a while reworking it for the increased load after St. Pancras reopened
Observes the release of BarCampLondon4 tickets last phase
Right, so that's 54 rounded off, though the middle's a bit jumpy. Another half dozen or so and this might even be ready for release. Crikey.
I have become Judgement. I hate being Judgement, the wig doesn't suit me, the robe doesn't fit, and I never know how long a life sentence is
The USA Gov have refactored Gitamo bay's imprisoning strategy to fill in all cells from the right side, This renders it perfectly justified.
Considering http://www.instantrimshot.com/ as the new http://joke.popey.com
@rands I use @rtm as a twitter-based to-do service.
TheLondonPaper has an article about how 'normal' girls can pick up geeks. She says hi, they react as if someone says hi. Ends.
Have finished being Judgement. Depressed by Judgement, am now heading to the pub.
@ppfichi nobody here but us chickens
Plotting George Galloway's trip though London by other people's Tweets. He's on his way down Grays Inn Road towards Kings Cross St. Pancras.
Hurrah! I win by the awesome power of grammatical pedantry!
@intranation Doesn't "No internets fail" mean that you fail at not having internets and therefore have internets?
Heading to De Hems with the Trutap dev team
At the london scifi film thing
Have now seen one of the limited ed. Batman trailers, eelgirl and dante 01
Alarm response fail. Brain no wakey. Third time this week.
@secretlondon Rargh. Short-sightedness make baby kittens cry.
@secretlondon Please tell me they don't actually live in London? And they don't want us to vote for Boris for the lulz?
@catashton "Food"
@gilmae Naturally, Quintessentially English. As I sit here drinking tea, complaining about the weather, and being entirely crap at cricket.
I have a theory. It's a trick by the government, and if Boris gets it they'll abolish the mayor's office as we don't deserve nice things.
At sub standards lego
This bar has christmas trees, because they are Nordic. This is a nordic bar. The trees have lights
@secretlondon You don't, multiple people do, all in the same place at the same time, or over tinternets.
@secretlondon It's like Guitar Hero, but with Drums, Guitar (or two) and Mike all at the same time. I expect to be entertainingly bad at it,
Obviously, this is all in preparation for accidentally buying Rock Band next month. Planning accidents far in advance for the absolute win.
Not even the browser. I was waiting for a bus outside Game, and failed my resistance to shiny roll. Actual physical real world buying stuff!
Accidentally bought a 360 and GTA IV last night. Critical Fail.
Having a nerf fight in the office
Doomed.
Boris has been in charge less than 12 hours and TFL's already gone to hell
At gamecamp. Venue is absolutly glorious
#Gamecamp is great, venue is some kind of sony pr pad, geeky as anything.
#Gamecamp was awesome. Home now, then party.
Attempting to remember which of these flats is @abigailb's
@mollydotcom I'd fill a building with them overnight and wait for someone to open a door in the morning
Leaving the fictional town. Puppy still cute. Cousins still energetic.
OK, Right. And this is a "Tuesday" is it? I've heard of these, I'm sure. Not impressed so far, needs more sparkles and slightly less cowbell
http://xefer.com/twitter/aquarion Never did get the hang of tuesdays.
Drinking beer in the sunshine
@kianryan You assume.... poorly
@kianryan Incidentally, best tool I've found for FTP (and SFTP/SSH) over OS X is MacFusion, http://tinyurl.com/25us47
More beer, more sunshine.
It is fairly typical that last weekend I left my sunglasses at my parents' home, given this is the most sun we've had since moving to London
TFI Friday
Wonders at the offspring of @rossbruniges and paypal.
Via @rnalexander, the decline and fall of western civilization: http://tinyurl.com/4bb3vc we are all very, very doomed.
Cambridge in the sunshine. Long time no see
In front: insane woman threatening murder down her mobile. Behind: music on speaker. Enjoying my london bus experience tonight.
Further observation: she doesn't have a mobile and is shouting her side of apparently random conversations.
A nice day, bright with the promise of spring. The birds are singing, the horses are galloping in the fields. Today I shall play video games
On the edge of my seat watching @workingwithme's epic lock tale. _This_ is the day when twitter finally is the central medium for vital news
Developing a minor addiction to Hexic
Hello happy smiley monday people! Welcome to another joyous week in the happy world of the future!
setting up macbook pro
@oscarhocklee Twitter chorus. It's stopped now.
Help. I'm being veeeeery sloooooowly riiiiiiickrolled...
Great Victorian Inventions That Never Quite Made It, Number 47 in a series of 78: The Steam Powered Kettle.
Writing unit tests while mainlining Bach
Heading into LOTRO
is also reviewing code. Today is apparently code review day.
@loresjoberg Space Hoppers
By request: http://www.aquarionics.com/fun/lemming/back.html
@jamesk Because if it wasn't they'd have been able to spare us phpBB3
Ah, right. 4:30. I should sleep, I guess.
(I will not be at the hack day thing. I will be in the middle of a field directing people with rubber swords who to hit and how hard)
BBC Hack Day 2008 tickets available: http://mashed08.eventbrite.com/
@rnalexander Yes, I'm getting fails for feeds themselves, but folders appear to work fine.
@kianryan : You are merely missing the required amount of context in which it makes perfect and rational sense. In a normal and perfect way.
lol! Paper can haz FAIL! Invisible proofs! I had a thesis but I ated it!
@abigailb Are you absolutely sure it's not your building being demolished?
@abigailb In the event of an emergency the windows are located here, here and here.
Place marking: cambridge
Playing dwarf fortress in the cambridge sun
No longer playing Dwarf Fortress in sunny cambridge. Instead playing whackamole with bugs in muggy London. Double-plus-ungood
Working from home
Just got my ticket checked on the bus. First time ever
http://www.vimeo.com/facebookgangsta
Have achieved pub
The plough, holborn
I am so early for work that the station doors were locked when I got here
Watching iron man. Will be at pub late.
Y'all don't mind if I don't go back and read five days of twitter updates, do you? Cool.
@doseybat Oh dear. Er. Sorry about that :-)
So, this is Monday, is it? Not currently impressed, please to be returning my weekend, previously in progress.
Stopped playing GTA4 at 3am due to insomnia. Today may or may not be a success, depending on whether I fall asleep in the meetings.
In da pub
irrationally irritated at the entire universe. Leaving office to attempt to acquire perspective. Also: Lunch.
Fzwz.
Why are there always rail replacement services when i have a large bag?
Some day, you will be loved.
The twitter haiku meme // is a good and fun idea // I can't think of one :(
@kianryan FYI, I've had problems with FCKedit and Fx3
Feeling the need to recommend people visit http://yvettesbridalformal.com/index.htm
((It is important // For all attempts at haiku // To reference seasons))
Pronunciation // Defines Syllable number // Also: Cherry trees
((The double brackets // Mean I'm not in character \\ Which is obvious))
((Oh, Neon fucksocks // That one didn't didn't have a ref // "Green leaves are pretty"?))
Houseguests mean I get to work earlier, and therefore are to be encouraged.
http://tinyurl.com/6b6ayx
is the king of toast.
Oh, Happy Bloody Colonials Day, Twitterarti
SUPRISE PAAMAYIM NEKUDOTAYIM!
Nightswimming
Have achieved pub. Pub is exceptionally quiet
London Underground // Woe for those crushed as sardines \\ A gentle rain soaks London
Pondering whether // you can cleave a word in twain \\ and still claim haiku
Coffee! Oh so yes // I hadn't thought of coffee \\ As the raindrops fall.
Slightly drunk at walthamstow bus  station. A popular combination
@abscond Maybe there are more of them on a less geeky network, like Undernet or something.
Heading to Walthamstow to see if I'm likely to get an iPhone today.
Less than completly suprised at the queue outside o2
Project i Phone failed. Carphone Warehouse ran out while they ran credit checks for upgrade
@molly But it's the retail event of the millennium! Again! We're not kidding this time!
@kianryan I believe once the check goes though I've automatically got one reserved somewhere in the country, I just don't know where.
I have an iPhone
@kianryan How is your roof standing up?
Regents Park is calm and pleasant. I should remember this more often.
@dakegra Yes
For it is written that while he who controls the spice, controls the universe; he who saves cheerleader the saves the world.
leaving the office
I am baking cake. I AM THE BAKER OF CAKE. See the icon?! Cake!
Fail: http://tinyurl.com/5px3f2
Wandering up for a weekend's LARP at Maelstrom.
Back from camping. All fine save the way my door keys are in York. Going to Parents' for a long bath before panic sets in. Weekend was great
Not sure how I got to talking about the evil overlord list with the bloke next to me on the train. Life is odd.
I have collected replacement keys. I have made it to work. Hopefully I've run out of FAIL for the time being
@kianryan  You might think so.
Doubling my normal weekly coffee intake. On monday. This may not be good.
Morning twitterarti
@kianryan The moleskine of order is in the bag of possessions, in the city of York, though my door keys of security have returned to me.
With the application of caffeine does this world become possible, with the application of lists does it become ordered.
Is you is, or is you ain't, or are you just resigned to your fate?
Realizing that the "mod_rewrite makes Apache Segfault" game sucks, and playing Hungry, Hungry Hippos instead.
Playing the "mod_rewrite makes Apache Segfault" game
I have defeated mod_rewrite.  One of us is victorious. One lies quivering in the corner. Sadly, they're both me. A somewhat pyretic victory.
Today is Sysadmin Appreciation Day. Appreciate your sysadmin, while you still have an internet connection.
It ain't no use to sit and wonder how.
Losing a nerf gun battle
Just coming out of Wall-E. It was beautiful.
Playing Munchkin Cthulu at the pub
Last Orders. Drinking Blackfriars Old Habit. Shiny, and 5.6%. Fzzzt.
Wondering what on earth convinced my brain that I needed an injection of 05:30 into my monday.
Applying my own personal sound scheme to Adium, carefully and subtly named "STOP FUCKING BEEPING AT ME".
Listening to The Now Show slamming Bonekickers
Lack of tea causes terrorism
Can haz barcamp brighton 3 ticket
Running unit tests is the new waiting for code to compile
@kianryan A chess clock?
@resiak An end, mister Thompson. An end.
Inflicting Pulp on the office.
Political discussion at developer lunch. Yay.
I have bought an iron. Despair.
@sil Yes
Went to see Dark Knight midnight show. Now suffering night bus.
There's a large spider above you.
Upgrading to iPhone 2.0.1, and hoping the thing where the keyboard stops working stops happening
@imoan And that with 2.0.1 just out today
@mpettitt Replace all styles with {background-color: pink; border: 10px solid orange; position: absolute; top: 0; left: 0; display: block; }
@natbat & @mollydotcom I tend to regard any code that goes up with !important as bugged. I also read it as not-important every damn time.
Pub. Chocolate Stout. Yum
Losing at poker
Treble booked on which pub to go to now. Alas.
Having moved my iCal/GoogleCal sync from Spanning Sync to the Official CalDev stuff, I now can't sync them with the iPhone.  Hate computers.
@ahruman & @imoan Yup, saw the DF article this morning.  Spanning Sync does the same thing as the BusySync thing he mentions at the end.
Was going to go to lunch. London is now being flooded by floods of flood. Bah.
Hating on the official Facebook API PHP libraries. Again. Still. Forever.
@smin a) Does this mean you're in London, and b) Are you going to the beer festival?
Heading to the Great British Beer Festival
At the beer festival. Yay beer
The band is blowing dixie, double four time
Opening Ceremony looks interesting. Suspect 2012 version will be Brian Blessed in an empty field playing "Grandpa" on the spoons.
@resiak I'd recommend beer to try, but I can't remember any of the names. They were nice, though
@poleprincess Across the universe, people all over the internet are joined by gazing at computers while drinking coffee. This is the Future.
Sips fresh, free coffee and makes sympathetic noises at the bits of the twitterarti having coffee fail mornings.
Is going to be attending barcamp london 5
Attempting to shift my workflow into Omnifocus.
@dakegra An an ocean of fail in a very small bucket
@ruthi It's close enough for Jazz, and with any luck they can't tell.
Discovered I've left my card at home just as I got to the cash machine. Emergency Subway Lunch Time.
@kianryan System Preferences > Security > Disable Remote
@sil OTOH, they should identify to you first, possibly with one of the more obscure bits of security on your account
@smin Also, you can set double-tap of the home button to launch iPod, which even works when the phone is locked so you can change tracks.
Am at the pub drinking perry, which is out of character
@emmapersky dead on
ssh for iPhone - based on PuTTY - isn't available in the UK due to "Export Restrictions". This amuses me.
Fending off zombies
@dotwaffle Indeed it is, but because of where it's being distributed as a binary, life is more complicated. I think.
@mpettitt Burning the suggester at the stake and scattering their ashes to the four winds while chanting "The Web Is Not A Print Medium"
Recommending @schwuk and @brunobord look at http://foamee.com for a beer distribution protocol
To find secret gold on a mountain trail in the andes, they dream of following the trail to the setting sun and the mysterious cities of gold
Observes that http://www.tweetsms.com/ look like they're going to do roughly what he was
Heading to #pubstandards
Slightly hungover.
@murkee Your site is spamming my twitter feed.
@sil Interesting, but would require a social notification layer on top of people uploading stuff, which means I have to do something :-)
@intranation Looks ideal, but closed beta
So, internet, a site for sharing files between a defined group of people. Recommendations? (Pownce doesn't count, shares go to all friends).
@dakegra Free version doesn't do file sharing.
I need a more self assertive RSI monitor. This one just goes away when I click "postpone" so I never take any rest breaks ever.
Bedford. Long time no see.
Back in London after @smin's wedding reception
@dotwaffle An idea with grace and artistry
@dotwaffle You're in London too now?
Moving away from the anime avatar especially for @kapowaz
Am stupid pillock, have trojaned my Windows box. Have ripped out network cable and am nuking from orbit. Rargh.
pessimising
Donating @kianryan a handy beanstalk he keeps for this purpose.
At @random_c's leaving do
watching the syncronised swimming. On mute. It looks very silly indeed
In the deserts of sudan, and the gardens of japan. From milan, to yakatan. Every woman's every men.
On today's internet: It's not actually a glitch: http://tinyurl.com/59nlp3
I used to pass the Cardington hangers every day on the bus to Evolving. They are huge. Part of Batman Begins was filmed in them as Gotham.
is practicing advanced duck alignment systems.
Head to the Pembury
Being taught how to drink whisky
on a drunken adventure
Today has started with lumpy milk and new, black, coffee. It will improve, or it will be shot.
Today, I have learnt that you can right-click URLs in OS X terminal to open them. I have been looking for this feature for months.
is quite literally swearing at nothing.
SubStandards Uffington, 28th Aug 2008: http://upcoming.yahoo.com/event/1047911
Being sarcastic at people on the internets
Here. Beer.
I am the three thousanth follower of @JohnCleese. Hurrah! Listening to the Ferret Song in celebration.
@warrenellis This makes you exactly 233.33r% better than John Cleese, should twitter actually be a popularity contest.
@intranation It appears to pick one randomly at reload. THat might mean more...
Ben Folds has 'leaked' a fake version of his new album: http://tinyurl.com/6ehqpm
@sil are you planning to be at substandards tonight?
@doseybat It's lunchtime
@jamieo You're afraid of Nevada?
Hoegaarden & fish finger sandwiches. Pub lunch of godhood.
Sarah Palin as VP is interesting, as it points to a desire to distract the people who supported Hilary as a woman - rather than Dem - PotUS.
@intranation People bitching on a text based communications protocol? SAY IT AIN'T SO!
Mojito Friday!
crushed
Watching Catch 22
is cursing the name of whoever told the coffee machine to only generate half a cup of coffee
is a public service announcement:
@emmapersky The feeling of educating the twitterarti to your  every thought? A popular feeling indeed...
Returning from lunch and Open Source Licensing <del>argument</del><ins>Free and frank exchange of personal views</ins
is a bad ambassador for that elusive place you're searching for.
Felicia Day singing Still Alive! http://tinyurl.com/6ldmnp
@smin <london> Hello Tom!
is becoming less and less impressed with Zend_Form by the minute
@intranation I dunno, it's a bit windy. Will they be attaching her to some kind of anchor?
Planning a trip to http://www.holylandexperience.com/
In a field. Pickled in vodka. On fire
Public transport slows down when you're in a hurry. Today: it stops, head back to maelstrom after shower and dry boots run.
Back home. Happy I don't have work today. EPIC LAUNDRY, I have carted home all the mud in the world.
Still doing Laundry, playing Spore, reading Nation. Today I shall be mostly relaxing.
@sil Belated reply, but Spore is worth it, but isn't available for the Wii
Seeking Knowledge, Information, Data and Wisdom.
Upgraded to iTunes 8. World hasn't ended yet. Watching iTunes Geniusize my music library v.e.r.y. v.e.r.y. s.l.o.w.l.y.
is suffering.
is sure there's a reason he's woken up at 03:30, and is now in search of what it was.\n\nWith a shotgun.
Looks like I'm going to Future of Mobile.
has no problem with people being addicted  to WoW, but finds it distressing so many people are hooked on the MMO equivalent of Eastenders.
Returning early from Pubstandards
Still no iPhone 2.1
Reading webcomics and syncing projects directories
Sitting in the pembury waiting for @kianryan
@kianryan fireeagle
Having something of an Epic few weeks.
Boom d'yada, boom d'yada, boom d'yada, boom d'yada.
I write the B-Sides that make a small portion of the world cry. I like the seaside and making songs that make you not want to die.
Things to do: Give lobby key to organic delivery man so he doesn't have to wake me up at 05:30
Am listening to @smin's brother's album and enjoying it a lot
@sil because nothing linuxy supported it. Now it does that's quite a lot more likely.
"We're sorry, but your Google Mail account is currently experiencing errors." Relying on a service fail :(
@workingwithme Odd, it was turned off by default for me.
@sil the answer is "It really should work, the software supports it, a couple of people are having problems with it"
Heading to meetingy thing
...or not. Damned bugs
Fzwzd! Kzzzt mphfff exulafdag? TEA!
Tea and 1st Anniversary Of TT Launch Cake.
I know an exception who followed a try, perhaps she'll die
Listening to Captain Tractor and Alestorm
@freakymousemats Because you flu with them.
Opera mini is doing horrible, horrible braindead things and I need it to stop.
Beer and cigars are a good way to end a week.
Attaching myself to the BCL5 backnetwork
http://SearchEngineRapBattle.com is as painful as it looks.
Tell us you habits, your facts, your fears
getting increasingly more fucked off as the afternoon progresses.
@kapowaz @journeyplanner
@rossbruniges Didn't think he was working with you anymore
is having difficulty mixing the concepts "important" and "football game"
Pub? Pub! Pub.
Tell me why I don't like Wednesdays?
@gilmae Happy to help
@nyecamden This could be it
@kianryan sharp symbol rather than hash, yes.
@kianryan Kindasorta. Problem this morning where everyone turned into the middle classes and the entire town starved, now got different bugs
Oops. Up all night coding economic subsystems for forthcoming piracy game.
is just a soul whose intentions are good
"What do you mean this has never worked" only ever happens after 17:10
@emmapersky ... I think you need to take your locale setting off "en.zombie"
Tonight: Pembury Tav. Tomorrow: Maelfroth meet. Thurs: Pubstandards. Fri: MOSAIC meeting. Weekend: Fall over.
It's official. Sign-up flow meetings give me a headache.
@chrisnicolson The solution is to buy a jar of Tesco Value Instant Coffee. The thought of it will keep you from ever running out ever again.
Oh arsebiscuits.
day++ dollar++
@carlfish Not if time machine hooks into Spotlight to do the backup searching and excludes it from the main index. I hope.
Heading towards the standards of sub
Is failing to rule the world with love
@sil First couple of gig is free, 50 gig for $10/month
is finding ruling the world with cake to be impractical.
Subjecting the office to The Final Countdown out of pure malice
Saturday is lie in day. Meaning I'm up at 8:30 instead of 6:30. My brain doesn't like me much.
is going to help @abigailb in his capacity as local rep for the society for putting things into boxes that were not previously in boxes.
Went to Starbucks. Now have six pages of notes on the game I'm helping design. This is why I need to remember to go out at weekends. Chai++.
Heading to the pembury
Woe
this weekend, discovered that Fentiman's Cola and laphroaig works quite well, and is heretical enough to get interesting reactions.
I hear that Iron Man is just another Superhobo flick
@spam @joeanus
@ruthi Hurrah! *tea*
@catashton Aim better :-P
@catashton Sure
is being anoyed by fiction.
@dsingleton Usually that's "Fucksocks, saving session failed" IME
too long you've wandered in winter, far from my far-reaching gaze
is Nicholas Avenell, and he approves this message.
@secretlondon Future of Web Apps. A conference happening soon.
@mollydotcom Yes
The world is going to doom, the economy is collapsing, but all this is rendered nill by the fact that the office is out of ginger beer. Woe.
is just another sign of the times
Welcoming @stephenfry to the twitterarti
Icanhascheeseburger meet less fail than expected
@ruthi ordering one now
is now stalking people he met last night
is reticulating splines
@ali_in_london *whimper* and also *want*
is catching up on twitter while @i-moan continues to fork-bomb the dev servers
Night full of epic win, morning full of epic flail. Red wizard needs bacon badly.
Playing a chicken in LOTRO: http://cenote.gkhs.net/~aquarion/ScreenShot00027.jpg
is learning more and more than he ever thought he would about... yarn.
is at work! And this is a good thing, oh yes.
@nyecamden Something like that, yes
Firebeagle is the new reverse version of FireEagle that tells _you_ where you are. It's like FireEagle, but more snoopy.
@dakegra putty
@secretlondon People in "interested in different things" shocker.
@nyecamden Robert Scoble is an industry-famous tech blogger, used to work for Microsoft. His twitter stream is famously... prolific.
According to followcost.com, my twitter rate is 115.28 milliscobles
Listening to the electric banjo
@dakegra Er. Mistweet, Was actually a reply to someone else :) Since you ask, though http://2dboy.com/games.php
@dakegra NTFO,ITOWTBS
OH: "You have a ticket in this milestone" "It's going swimmingly. When's the deadline?" "Yesterday" "What?!"
OH "I don't even know what's east of London, citywise"
thinks that the SNL Tina Fey/Sarah Palin skit collapsed a bit when the real one got involved.
In modern times /// The people see /// And blindly follow /// @XKCD /// Burma Shave.
thinking about fail // And a future cup of tea // The rain clatters down
http://twitpic.com/hfpw
@ahruman To quote Mr Ogden, Opinion is split between those who see us drifting towards 1984, and those who saw V For Vendetta first.
is the king of the beavers, the king of the beavers, he cannot deceive us, and he can't fool owls.
building faffery to work against a shenanigans-based system.
@codepo8 So, now you discover how many twitter tag parsers support non alphanumeric tags
Another day, another train, another week over. Complexity up, happiness up. Guilt over same also up. Checks & balances
http://twitpic.com/i4si Brighton is not very warm today
On a midnight tour of Brighton
@warrenellis You'd have to fight @stephenfry for control of the twitterarti
@dakegra Any of the five just under the navigation strip are good starting points
At the end of the day it's another day over.  http://twitpic.com/imnw
@cackhanded 25% of all bacon sold is actually made from dinosaurs. There's a bacon stat.
@merixzon Gosh. Are you our marketing department now?
is ranting at PHP at some length
Trac Hilarity: http://www.flickr.com/photos/aquarion/2986764230/
@sil Almost always, yes. The only device I've ever plugged in that didn't have complete functionality from go was a MS Keyboard
At @jonathancoulton concert
Tonight I got rickrolled by @jonathancoulton
She's touring the facility and picking up the slack
Slow Train back from cambs is sloooooow. Larping on halloween is odd. Fallout 3 is waiting for me at home. Hello Broxburne. Multitwitter ftw
@NeilCrosby http://tinyurl.com/565fge
A weekend of computer games, mulled mead and shiny people. Now back at work.
At the pub, drinking mulled mead.
Will not be voting today.
is astoundingly happy that he's on holiday just in time to discover his fridge/freezer hasn't been doing either for days.
Time spent writing entry: 15min. Time spent redoing blockquotes on AqCom to look cooler: 2hr. Readers of AqCom not using an RSS reader: 4.
@ali_in_london Congratulations!
Heading to t'Pembury after epic weekend of win, but mostly of epicality.
Discovering how much of my grocery shopping assumes I have a working fridge.
is back at work after time off. I can haz moar holidayze plz?
@sil Many congratulations!
@kianryan There are two, incidentally. Either way, I'm stuck in officeworld
is reticulating splines
is heading off to a beer festival in hackney
If McCain had come across during the campaign half as well as he did on Leno, he possibly woudn't have lost. http://tinyurl.com/68qggb
my Twitterank is 69.2! http://twitterank.com/view/aquarion
has discovered that if you rest a weak magnet on a Macbook Pro (over the IRDA port on the right) it instantly puts the box into sleep mode.
@dakegra Not at all. I put my phone (the case has a magnet on it) on top as it was charging, and my laptop went to sleep. It was strange.
@sil You may be the only web-python bloke in existence who doesn't already have a weblog system in django half written.
@sil Obviously I mean Vellum, and was referring to Castalian anyway and forgetting the name. I wish you could delete tweets...
@sil You should write your own weblog/cms thing. Call it Castellan or something...
@brunobord / @sil: And I have one that was powering part of http://www.piracyinc.com/ until the hosting fell over.
is wondering why the hell he's getting Arsenal press releases
@imoan It's not actually better, because twitter doesn't send you @ replies that are not either you or on your friends list
@kianryan Cliffs of Dover just played on the office stereo. Likewise. Fortunatly, I have my Wii and GH3 set in my bag...
Heading to the pub to celebrate new http://www.trutap.com launch, and preparing for fun work stuff next week.
Is experiencing the wit and wonder of Farnsbrough Station.
Is back from Devon and wishing he were still there.
Heading to the Future of Mobile conference. It's in the FUTURE! (Not far in the future. Like, 8 minutes. But I'm going to be late anyway)
At #fom watching Doug announce @Trutap's new version and theory of existence
Watching @twhume's #fom presentation on developing for multiple mobile platforms
Giving personalised techsupport at #fom for @trutap.
@hikariuk As the "@" thing, it started off as a convention, then became a feature. So now, #thing is a tag for "thing" to make it searchable
The glitz and the glamour of #FoM behind me, now back on code & coffee
Hurrah. Twitter's back! Now I can go home.
is cultivating mint plants. Yes I'm still at work, why do you ask?
@catashton    Your keyboard does not need nourishment in the same way as humans and pets. Keyboard food can be found at your local pet shop.
@actelus It broke into your computer and stole your data?
is going back though the Facebook Apps docs. Excitement! Adventure! Really Wild Things!
is perfectly sure that one day he will look back at today and laugh and laugh and laugh and laugh. For now, however, wants to go back to bed
@Sarabian It only affects your personalized google results though
@abigailb I'll be around, as will Clare
@Sarabian iPlayer to the rescue. Assuming you hate freedom
@smin ITYM AUTTE
@ahruman Not yet :)
Is no longer fishing for spotify invites.
@dotwaffle I have been given one, thank you
Fishing for a spotify invite.
@stephenfry Um. But surely the only people who know about this contest are the preexisting 19,950 members loyal army of followers?
For those of you who asked: By Magpie I mean this: http://be-a-magpie.com/faq
FYI: Anyone posting "Magpie" tweets will be unfollowed with extreme prejudice. Do. Not. Want.
can't sleep, his bed's on fire.
Did you hear of the escaped Bee convict who was allergic to jail? He broke out in hives.
Having a day of recruiters. Have just been asked if I want to apply at a Bedford company called "Evolving Media"
In a starbucks in Cambridge, slowly being driven insane by Christmas music
Has finished an all night cinema LOTR all marathon. Now somewhat tired.
Apparently if you bowl backwards people really do leap in the air and turn to face you.
Preinterview ritual. Find place an hour beforehand, find nearby cafe, drink tea and worry. Currently next door to Mornington Crescent.
@jemimakiss Go for Leopard, Snow Leopard's at least six months out and Leopard's worth the upgrade,
Naturally the day my interviews start is the day I cut myself shaving. I am forced to assume that the person writing my life script is lazy.
I think that went quite well. I hope it did, anyway.
is not sure that #nsid should be so close to Movember.  http://www.noshavingindecember.org/
Apparently the interview did go well, which is always nice to know.
@catashton http://www.silverex.org/news/ X-Chat
is a mean individual stranded in a limousine.
@imoan Ravioli code? You mean it's been well packaged and stuff?
Whilst I realize this isn't a position to whine about, I seriously have too many interviews this week, and it's starting to fall apart a bit
@s_callan Sure, but they'll be London-based PHP webdev things :)
thinks that the waiting game sucks, and would prefer to be playing hungry, hungry hippos.
Belgos for lunch. Nom
had forgotten about substandards and went home after last interview
Another day. Another interview. Two, in fact. At this point I'm lucky to remember the names and addresses. Wondering if I'm too ill to go.
has no more interviews booked, is slightly fried from explaining his CV too much, and now is waiting for recruiters and other such people.
To @trutap_test00 yes it does
is not enjoying being ill. Is not enjoying waiting for recruiters. Is suspecting that the job he actually wants is being fucked up by same.
is a towering powerhouse of productivity. Bugs will fall, crushed beneath his might code-hammer. At some point. After coffee.
Checking out my TweetStats! http://tweetstats.com/graphs/Aquarion
playing with ping.fm and seeing if it works.
Fucksocks. Company I actually wanted to work for came back though recruiter to say "No". Hate job seeking.
@secretlondon Wouldn't expect to. Even if IWF came to a conclusion, the blacklist updates are probably automated to happen overnight.
is of the opinion that @kapowaz is fully entitled to his wrong opinion.
is playing with facebook APIs again
@schwuk Er. Chai doesn't usually contain caffeine
Is spending an awful lot of time waiting for the number 48 bus
iphone battery fail causes Aquarionic lateness. News at 11.
OH: Schnapps is basically milk for grownups.
And Cenote.gkhs.net is back in action. Those responsible for the outage have been fed diet coke and mentos.
Hurrah. Someone's DDOSing my vhosted box's host. Internet in "Full of wankers' shocker. Cenote will be back shortly, loyal customers.
has got ipv6 outbound from his hosted machine. The astounding usefulness of this currently escapes him.
Pushing Daisies is fast becoming one of my favouite series' ever. I'm not at the end of the first episode yet.
@caomhin He's fine and entertaining until he gets onto the subject of religion, abortion and same sex marriage
"[Bopaboo.com] is preparing to launch the world's first second-hand store for MP3s" Er. What? I mean... What? http://tinyurl.com/6ovoo2
@trutap_test00 Tubes. It's always tubes
@coupde Yes, I suspect I do. I really should play with @peoplesmusic
@cazm They were THIS BIG! and it had teeth like pickaxes, too
Tesco's belgian white chocolate moose is a thing of joyous wonder. That is all.
@MerseyMal I generally use an ssh terminal and irssi. Rooms is an IRC client that people like, though it isn't free
@Sarabian All the best people start their acting careers playing Herod
Latest #trutap service launch (yesterday) adds Twitter support (works best if you're on the new interface). Down but not out yet :-)
RT @imoan: bopaboo is an attempt at getting into the Guinness book of records for highest settlement payout in history. I love mad people
There have been margaritas. Now there is wii. This may not end well
is in the process of turning his girlfriend into a redhead
@kianryan Not yet start of a new one, and yes, I no longer have a MBP
is clearing his desk, attempting to shift crap from his laptop before giving it back, finishing off his trutap life period.
That's it. Game over. No high score. Am now unemployed.
Up too early after getting to bed at 5am coding Interesting Things
Is back in Paddock Wood for a couple of days
I am now ranked 7th at Micro Olympics on #twoof. Bet you can't beat me http://twoof.doof.com/games/MicroOlympics
I just won a Silver Medal at Micro Olympics on #twoof. http://twoof.doof.com/games/MicroOlympics
I just played my first game of Micro Olympics on #twoof. Bet you can't beat my score http://twoof.doof.com/games/MicroOlympics
@kianryan Not this year, I'm heading down to Brighton.
is more employed than he was yesterday.
I've turned down when Twoof autotwitters, people can stop complaining at me now, please :)
I am now ranked 14th at Count Your Marbles on #twoof. Bet you can't beat me http://twoof.doof.com/games/Marbles
I am now ranked 22nd at Count Your Marbles on #twoof. Bet you can't beat me http://twoof.doof.com/games/Marbles
I just won a Gold Medal at Count Your Marbles on #twoof. http://twoof.doof.com/games/Marbles
I just played my first game of Count Your Marbles on #twoof. Bet you can't beat my score http://twoof.doof.com/games/Marbles
I just won a Silver Medal at Jumpin Ride on #twoof. http://twoof.doof.com/games/JumpinRide
I am now ranked 12th at Jumpin Ride on #twoof. Bet you can't beat me http://twoof.doof.com/games/JumpinRide
I am now ranked 25th at Jumpin Ride on #twoof. Bet you can't beat me http://twoof.doof.com/games/JumpinRide
I just played my first game of Jumpin Ride on #twoof. Bet you can't beat my score http://twoof.doof.com/games/JumpinRide
Now have clean kitchen. Working on my room. Attempting to start 2009 from a poisition of temporary victory over entropy.
Is sitting in a cafe in Brighton preparing to time travel
Right. Before Twitter falls over, of the phone network does, a happy new year to you and yours from planet Aquarion.
@fatbusinessman www.liquidledger.com
The fools on the bus go jibber jabber jibber, jibber jabber jibber, jibber jabber jibber. The fools
On the bus back to Keldaby after finally clearing my desk at Trutap. Tomorrow, a whole new world. Tonight: roast dinner and then pub
Adding his own "snow? WTF" to the dawning chorus, and my earphone are borked.
Train's delayed. Wrong sort of trains on the line, or something. Honestly. You'd think that icing the tracks would make trains run *faster*.
@brunobord by "whole twittersphere" you mean "bits of England" yes?
The next train will be the (now reappeared) 09.00 running 14 minutes late, followed by the 09.11, which is on time.
My train was "on time" until it vanished from the face of the timetable 2 minutes after it was due. London Overground: Thinking with portals
Is motivated to make his flat's heating work. Bed was toasty warm, rest of world less so.
Is highly amused by @simx's submitted Firefox bug: http://tinyurl.com/76qjsq
Is sure he had a weekend around here somewhere. Where did it go?
Mac Tip: When installing the new firmware update, it appears to Grey Screen Of Death if you have an iPod attached. Poss all external drives?
Wishing flash's security policy was less annoying.
Is heading in to work to unbork a server
Fixed server. world spinning again. Fixed things so he doesn't have to go to camden again today. Going the hell home.
Is at the flounce meet in the Pembury
is distressingly 28.
RT @DoofHQ : £50 iTune Voucher Prize to todays top SNAKE player on #twoof - http://is.gd/eaIY - May the Best Twitterer Win!
Is at the international gaming expo
yeah. Much more industrial construction
Guitar hero arcade version is interesting. The guitar Is easily twice as heavy
Practical Sysadminship: Firewalling the IP which is flooding the upload bandwidth for the office, and waiting to see who complains.
is wondering in exactly what universe Oysterband is classified as "reggae" or - more precisely - why it appears to be in this one.
Hackney is being snowed upon\n http://twitpic.com/1adf2
Today: Is not a good day. The new firmware install bricked my iPhone (needed a full restore). And I'm going to have to go out in the snow :(
Discussing modern verses renassiance humanism. In the pub. Obviously.
@papervolcano I hate conducting interviews. It makes me feel like I'm judging people's entire career and worth. Partly because I kind of am.
is doing the dance of the decommissioning servers. It has a funky bass-beat.
@Sarabian Patently not a waste. You've changed the course of history!
Football fans: Our current predictionometer for the Carling Cup is a draw. Change it: http://www.doof.com/carlingcup/
Er. 90s.
"touch: cannot touch `this': Permission denied". 80s classics in unix form.
Is amused by the way @stephenfry  just has to mention something for it's tinyurl to appear in TwitScoop's tagcloud.
Oh, look. Snow. Super. I think the novelty of this has worn off. Plus, my iPhone appears to be "white screen with lines" level fucked. Great
@kapowaz So if I leave it off for a while it should be fine? I assumed it was a Return to Apple thing
@kapowaz Possibly different issue, then, as I've rebooted & restored to no avail.
@intranation Yeah. I've booked an appointment with the Apple Store. Google tells me they tend to replace handsets for this issue.
is interviewing PHP / Web Developers. DM me if you know anyone who might be interested.
@kapowaz Yup. When I turned it on it was all white screen and pink lines, so they checked it for water damage and then replaced it
Can has shiny new iPhone. Customer service win
Is amused but unsurprised by http://tinyurl.com/azwx6z and is working on the game about pirates.
is on his fourth cup of tea and counting. Tired day
@Livishort  ... too.... much.... tea..... ? Your concepts are strange and alien to me.
Life is a multicolored canvas upon a field of random things. Some things are up, some things are down, some things will be sharp when I land
is playing L4D. Find Aquarion on steam :)
is wired for sound
@stlemur  Actually... yes, pretty much exactly that.
Duck-typing is one of those really nice things that HURTS LIKE A BASTARD if something gets it wrong.
Is deserving if this pint of beer: http://twitpic.com/1f75v
Bother. @TweetDeck update has forgotten my groups and window setups. Warning would have been nice.
from __future__ import springtime
likes your "morning" concept but considers its implementation to be lacking in fundamental sympathy for the consumer.
Is rapidly approaching Cambridge, hoping he stops before he hits. Larping today, dancing tomorrow, pub on Sunday. A packed weekend.
is waking up to a beautiful morning of waffles, swords and sorcery followed by an evening of dancing while being shouted at by a bearded man
Is dancing ceilidh whilst not quite having sucessfully removed zombie makeup. My life is a little weird.
@mezzle disagree. If you stop doing something, doesn't mean you're doing what you were before in the general case.
Is noticing that if he leaves at 8;40 it takes an hour to get to work, and if he leaves at 9 it take half that
@Livishort  http://www.twitpic.com/
@LupieStardust I just bought you a twesent. Check it out here - http://twesents.com/76.
is recieving public transport woe
Recoding the entire damn stylesheet and wishing IE6 could just duck off and fie, like a good little obsolete collection of binary data.
Annoyingly, it appears that using visiting all of our users on company time to upgrade IE6 to Firefox, or at least IE7, is not scalable.
is California dreaming.
@intranation Would this be the epic fail where it occasionally overwrites your working file with a blank one, or the one where it truncates?
@MrMoth  I suspect that this may not be compatible with their long-term goals
is attempting to steel himself against another day attempting to make complicated things work in IE6.
Is wondering why his train carraige smells of fake banana
has finally completed psychonauts. Everyone should, at some point, play this game.
would support and accept @roryparle's objection, except his tweets are also his facebook status updates.
@hikariuk  Commute would be a bit of a bastard, wouldn't it?
@jtopper Some kind of drug they put in the aircon, I think
Drinking overpriced beer in back street london pub, waiting for hijinks to ensue
is writing speakers to home entertainment thingy. Discovering unknown ability to strip wires.
@andynatt Until you break into the A1 sheet flowchart, it's not a real signup system.
@ginader Foxmarks.com just launched a beta to sync both Fx and Saf bookmarks with them, which is how I'm doing that.
Having waited for the netbook delivery (8hr), collected it himself (4 hrs), and made it work on the wifi (2 hrs), now I can defenestrate it.
drinking Chocolate and Vanilla stout in the Pembury, whilst attempting to get some coding done. This is working better than you might think.
Upgrading piracyinc development base from Gutsy Gibbon to Intrepid Ibex and playing with Pinc's company name generator
is sitting in the pub with a beer, a sausage sandwich and wifi, watching wet people hurry past the window.
There is a time and a place for storing session data encrypted in a cookie without any size checking. The time is now, the place is hell.
watching a flurry of SXSW tweets start, and wishing @tweetdeck allowed him to filter "people not in group SXSW"
@dotwaffle Turn off autocorrect?
Is heading to pubstandards
@catashton It's because you lied when you were seventeen
General information: My bag was stolen, including phone, laptop, wallet, keys and everything. If you're expecting me to phone you: don't.
removing "works for doof" from his twitter bio. Anyone hiring PHP devs?
@random_c Nope. No meep. Twitter is ephemeral. If people expect you to read everything they throw up here, throw bricks at them.
@jreast @vanGratton Actually, I got contacted by Lovefilm directly a short time ago asking for ideas for an official API. I'm happy to chat.
is answering an interview question on "How would you host the perfect dinner party".  There I was thinking this was going to be a tech job..
Preinterview ritual of coffee and calm spoilt by coffee shop closing early.\n Bah
thinking that today's interview went well, and finishing off writing dinner-party guides for Thursday's. Hate job hunting.
has returned to being Gainfully Employed, this time by @skimbit
@chrisnicolson Only to vodafone users
Anyone heard of anything that accesses "http://$hostname/notified-Compliance_Notice" ?
Scary command line of the day: rm -rf backup
returns from playing fussball in the basement while drinking beer and eating cake and strawberries. life is hard.
@jtopper: This was a birthday party, so some excuse. And we don't do nothing. Just this morning I rm'd the svn backups. progress is good.
Insurance claim has gone through, and i am again an ipod iperson.
Good: Look Around You.  Bad: iPhone restore takes FOREVER, and performs the HIDEOUS SIN of foregrounding iTunes' window every few mintues
Today has started badly.
is pointing people with revolutionary new solutions to the email spam problem at a filled out copy of http://craphound.com/spamsolutions.txt
@markofmac  I just sent you a twesent. Check it out here - http://twesents.com/-f5d35d.
I HaVE COfFEe aNd sO THiS MoRNiNG SHAll LivE.
Good Morning! Hello oh happy world that has such mornings in it! Greetings oh wondrous day!
@sil The design's light, but you average a couple of pictures per entry, and quite a lot of entries on the front page. I'd ignore them :-)
Pub. Mead. Friends. Yay.
in base four I'm fine.
My new view http://twitpic.com/2wyks
Yes, @ahruman, my cheesecake brings everyone to the yard. I'd make it, but I've have to charge. No. Wait. Nevermind, I'll do it anyway.
@LupieStardust It should be a euphemism.
can has network.
Has new desk. New desk does not have network. Productivity may not be high
You are disoriented. Blackness swims toward you like a school of eels who have just seen something that eels like a lot. #dna
Is preparing to go to Maelstrom for four days of hitting people with latex weaponry somewhere in the fields of England.
In a field in derbyshire, drinking mead and talking toot\n\nhttp://bit.ly/A99J8
is a mean individual, stranded in a limousine
Tired this dull morning // brain barely shifts to first gear // tea will solve all this
Raining at my work // drip-drop over switching box // net down. Send us tea.
@SMTRodent Bit late, but try http://tinyurl.com/45rrq7
Is ensuring his day will get better by starting it with a vista install
RT @castellan: There is no such thing as Science Fiction:http://www.design.philips.com/sites/philipsdesign/probes/projects/tattoo/index.page
@mpettitt On my work machine with the CPU virtualisation things, and seemless integration. Not even a little bit. Plus, IE7 testing for Free
Right. By installing 64 bit Vista inside Virtualbox on 64 bit Ubuntu, I can finally get Air apps (and therefore Tweetdeck) working again.
@tho99 This is true, but it came with Vista 64, and therefore I have a valid license for it. Getting an XP license seemed like overkill.
@catashton nothing but the finest cuban cigars, milady.
Can you imagine the things he'll achieve as a doctor, a lawyer or indian chief?
I complained about the music. Now we're listening to Wham. This should teach me something, I think.
As we stagger though the nighttime, and the moon climbs high, I hear the moans and the groans of a great zombie choir.
Linode upgraded my server's host machine. This broke my virtual server and stopped it booting. Linode have annoyed me this day, and my users
Astronomers testing a giant dust cloud at the heart of the Milky Way say it might taste of raspberries: http://bit.ly/badscience
There's now a pool table in the break room. When did that happen?
@turbine Hobbit, Elf, Human, Dwarf
kitchen floor is sparkling clean! Feeling all virtuous now. Now just every other floor in the flat to go. And the washing up. And laundry.
Today I have tidied the kitchen and completed Phoenix Wright 3. A worthy set of goals for a sunday.
A rainy london spring morning. Today is a day that requires the Blockheads.
Colouring in pandas
@isihac Bacon. It should cook bacon.l
@cazm bamboo eating kind
It is morning. I have coffee, so it must be morning. Back to the pandas.
Time between ordering replacement for stolen laptop and call from landlord about reports of water coming from my flat: 5 minutes.
Everything is fine, nothing is ruined. Apparently a false alarm, though landlord agent is visiting tomorrow to check
#iusedto work in a lab,  working out the exact amount of green salad required to make it look right, but it wasn't rocket science.
(I should point out that I did actually do all the jobs I'm adding to #iusedto)
#iusedto work at a factory that made lego boxes. but there wasn't anything to build on.
#iusedto work for the Royal Mail, but they just couldn't deliver.
#isuedto work in a stationery shop, but it wasn't going anywhere.
Congratulating @le_punk  on completing the office rubik's cube.
Is now measuring the distance between the pandas he coloured in yesterday
eating home made lasagne with home-made pasta, and feeling slightly smug about cooking it all :)
@hikariuk  Oh no! I'll have to bake my own cupcakes! The terrible tragedy that is my life :(
@orinoco77  It's the new version of the GPhone Operating System
doesn't believe in Cupcake. Suspects it of being a pie.
@hikariuk It's the GPhone 1.5 firmware update which dropped today
@MitchBenn Contrary to popular opinion, twitter obviously makes your every word more interesting
Investigating http://good.ly/aosee52. Or the HD version. Possibly.
I remain unconvinced that "in the ghetto" needed a vegas lounge cover.
@dapol @schwuk  I hosted my own email until I spent as much time maintaining spam solutions as I did doing shit I actually cared about.
Watching twitterfall.com search for "gmail"  is giving me a constant wave of fail.
Gmail is down, repeat, gmail is down. This is not a drill. This not any kind of hacksaw either. This is a level One geek panic scenario.
@ali_in_london Developers find a useful ops person and hang on to them like a bulldog clip. Optimizing for laziness seen as a positive trait
@ali_in_london It's worth trying, especially if you like gummi-cola-bottles.
Red Bull Cola tastes like cola flavoured sweets liquidized and carbonized. Not sure this is a good thing.
So. I just tried to use my office key fob to pass an oystercard reader. Today may need more coffee in it.
FTR, I'd like to be able to see anyone who mentions me. I don't care if this is done via #fixreplies or bringing back the "track" keyword
In Penny Lane there's a barber showing photographs of every head he's had the pleasure to have known. #beatlesfacts
@Cunobaros  I do, but I want to see replies from new people in real time, in the stream. "track $foo" used to be realtime search of $foo"
@cazm That's as I understand it. Nobody who doesn't follow both you an me will see this message
Sends @papervolcano a sympathetic kitten.
I have moved from "It doesn't look right in IE6" to "It causes IE6 to crash". I'd class this as improvement. Others disagree
is now colouring in doggies instead of pandas.
@apiphile I wanted to! But I had to go to the dogs. The alternative was pandamonium.
RT @skimhannahkeys: we're having a rave in the Skimlinks office. never thought i'd hear 'smack my bitch up' at my desk.
Quiet night at the pub
We've launched the thing I've been working on, and it's been featured in the Evening Standard. Good.ly: http://good.ly/twxajxz
@orinoco77 Specifically not PPC.  Only if they buy things.
Buying @skimhannahkeys a new checkers board
Erk. Good.ly's hit the Metro. Pity they didn't include a link to the actual web site or anything. http://good.ly/muco7ce
@orinoco77 Lots and lots, with economies of scale so we can get better rates. We  do the same sort of thing for websites with Skimlinks.com
@codepo8 How... special of them.
Watching @CiaranR suffer from IE6 Tourettes. Well, more coprolalia than tourettes, but I wouldn't want to send people running for wikipedia.
@paulfreeman Nothing actually wrong, but it doesn't do anything for the charity you select
@paulfreeman (a) Twitter autoshortened it. (b) Not being a comissionable link, there's no benefit to using good.ly for it :)
http://bit.ly/cEQIY
@paulfreeman Not yet
if you drink more than three litres of coke a day, it may cause health problems. I fell off my seat in shock.  http://tinyurl.com/qkaqca
@Livishort Neat. One of my coworkers runs retweet.it as a sideproject
@le_punk SOAP is. nusoap is at least better than SoapClient
is slightly amazed at the number of people using good.ly. I'm not used to writing things that people actually _use_.
@csbagnall http://good.ly
A silence descends on planet Skimlinks, as the noisy fan in my computer is put out of everyone else's misery.
10 Things You Didn't Know About Orgasm, http://digg.com/d1rhDA
@song_in_heart and likely to resort to senseless violins.
I once had to bury a furry elephant-like thing. It was a mammoth undertaking.
Star Trek was better than it had any right to be.
Hmm. It's going to take six hours to obtain the data for part of what i'm doing this morning. I sense an overrunning task...
http://bit.ly/tYLjb boiling water actually does freeze faster than normal water. The things you learn at #Skimbit
Doing minor sysadmin from @cambeerfest
Our office shredder isn't beefy enough. Need one of these: http://bit.ly/eJcxn
Oh, hello twitter.
repeating the current office conversation would get me kicked off twitter.
@orinoco77 That's a hell of a side effect, there. I'd recommend different pills if they turn you into monkey poo.
@LupieStardust http://www.tvadmusic.co.uk/
@orinoco77 I do wish OOo would give up on being like Office and concentrate on being *better* than office.
It's a reading test. Less "how long has divorce been legal", more 'have you read the "So, You want to live here? Do you play Cricket?"' book
@_gmh_ But it's not conker season. Besides which, I'm out of vinegar
I have now failed the UK Citizenship Test at http://www.ukcitizenshiptest.co.uk . Clearly I should now move.
@Xalior What you need is a nice double expresso or two. And apparently a new capslock key.
@apiphile Actually, I firmly believe that they're overquoted. Also, 3 Yorkshire men's from At Last the 1948 Show. But that's just pedantry.
@apiphile Oh, all the people are fine. Residents quote "Luxury. First time i' ben warm since my daddy set me on fire every morning"
@andynatt Unless it's about Bob the Builder or getting bitten by Charlie, I wouldn't trust a 3 year old to review things properly.
@O2 Omnifocus is very good
@apiphile World still exists. Except York, which has been bombed back to the viking age in order to rebalance Yorkshire.
@murkee The ability to collect a depot is reserved for people with a car. I do not have five hours in a work day to get to Barking and back.
Citylink are a collection of absolute fucking morons, and I absolutely resent spending most of my Saturday waiting for them to fuck up again
@dwm Erk. Sympathies. Heck of a Sysadmin's day present
. @catashton So as not to reenact E.M Snickery's beloved children's book, The Tall Man from Cornwall.
.@MrMoth Suddenly the entire cricket scoring system makes more sense to me than it ever has before.
Pouring with rain the day *after* a bank holiday weekend, weather systems? Now you're just mocking us.
Wishing that the network DNS would stop sucking
At #thesway
Home from #thesway followed by #thepembury. Is sleep time now.
Off for lunch with planet @skimlinks
@Cunobaros Where in the Standard are you? My company is on page 24...
@Cunobaros So you are, congratulations.
RT @paulcarr I fear hashtag memes are turning Twitter into a sea of #totalfuckingmorons
(incidentally, send me feedback on the "Filter Question" test on that. I'm interested in anyone who tries it :)
RT @CiaranR We @Skimlinks are looking for a Developer Intern & a Marketing Assistant Intern Know anybody interested? - http://good.ly/ejqzt
"Error importing item #7050" ARRRRRRRRRRRRRRRRRRRRRGH
@ciaranr http://yfrog.com/0xmi9j
New monkey island games coming out starting next month! http://www.telltalegames.com/monkeyisland ! SQUEEEE! (via @loresjoberg)
I was quite liking my Java-free  existence, and now I have a Java sandwich with Java instead of bread. And a small PHP pickle on top.
Is all about democracy today
Being rained on in a field near Long Eaton.
Back in London after being rained on. Slightly shattered. Still got to get home
A good metaphor is like the rubber sheet of the universe. Lean on it too hard, and it starts getting dangerously thin.
@cazm bit.ly allows you to see stats on how many people click your link. Obviously good.ly is even more preferable...
Has now been stuck in traffic for an hour and a half. Is halfway to work. Is not a happy commuter. #tubestrike
Is winding up the clockwork morning
@CiaranR I'm bringing some in bean form
@loresjoberg Flash 10, Firefox, Ubuntu 64bit. Not the highest demographic, I admit.
@loresjoberg Linux + Flash appears to screw up the fonts of that, only ever displaying the first name and the "&".
@codepo8 Yes. It also has "OMIGOD we think @Lastfm gave away data"
If you commit human rights abuses in order to hit carbon footprint targets, does that cancel out? http://good.ly/gwuoaf
By coffee alone do I keep my mind in motion.
@_gmh_ They listen to Warg at One.
@sil I know people who love Crumpler bags, but I find the syntheticness horrible. Nice shoulderbags don't shout "THIS PERSON HAS A LAPTOP".
is playing with searching with solar powered carrots.
@ruthi @oscarhocklee Congratulations :)
@cazm while national rail do fail, that's not one. That's a valid wap deck, and anything claiming to be a Mobile browser should support it.
@cazm Yeah, it is a bit. THere's a National Rail app which is really good, or use http://www.traintimes.org.uk/
@Artela @ahruman Tomorrow morning our time. It's when all the apps that can't handle +32bit ints go cabloom.
cazm I've found it really useful, especially for last trains and planning stuff. Some people find it crash-happy, though.
*now* my brain gets in to the habit of waking up before 8 again. Timing perfect. Thanks, brain. Thain.
@rnalexander facebook.com/username
Is putting down the deposit on the new flat
it is too nice a day to be writing XML DTDs. Mind you, hail the size of footballs could be falling and this would still be true.
@smin http://twitpic.com/7m0ao - Oh. Dear.
RT @SteveMarshall Enable tethering on iPhone for free: http://help.benm.at/help.php
@LinziMG Apple reduced it to ~$99 on launch of the new one, if O2 follow though on that.
@botherer Duke Special - No Cover Up - http://open.spotify.com/track/01MHCcffDgM1Gi0OrZZZv8
@stlemur as it happens, I was listening to a mashup of 99 Red Balloons / 99 Problems when I clicked that link, which was scary.
iPhone contacts crashed, taking all my contacts with in until next sync. Thanks Apple. Thapple.
@ciaranr's spotify is playing cliff Richard. Can take a hint. Going home.
@murkee The butler did it
@apiphile Y!M upgraded. Pidgin got fucked. New release will fix all woes.
XML feeds good. CSV files containing lists of XML feeds bad. XML feeds with no documented schema bad.
Sod the thriller jokes, I'm waiting for the first decent "Toxic burial site" one liner.
People appear to have been waiting for *years* to use some of these MJ lines.
Terrible problems to have: #nmaawards are very heavy, and @digijoe had to carry two of them in this morning.
@Cy75 sure. Kettle's on now
@orinoco77 It is, instead, some kind of hacksaw?
@kianryan Well. Unless it rains unexpectly, then you have to stop play while they put the roof up.
The @OpenRightsGroup are recruiting more people to protect our rights online. http://is.gd/1j2Mc
@abiphile so, insummary, you being creamed all over is the fault of your coworkers?
RT @TheOnion FT http://bit.ly/4LpyT
@warrenellis Yes, and cause me to discover interesting music I would otherwise never have heard. Thank you.
Morning world. Happy 142nd birthday Canada. Read this: http://bit.ly/WjwZV
Rargh. New landlord didn't submit some documents, so they hadn't even *started* checking references. Twelve days until move.
Occasionally, I feel the need to track down those giving me data and get access to either their bug tracking system or their beating hearts
@orinoco77 You could be one of the new kind of glitter vampires.
@sil Not *just* cigarettes. You have to have coffee too. Or tea.
@dotwaffle "Yes I was on that houseboat too"
@sil From my experience this works better if you don't also skip breakfast.
@sil I'd imagine that at some point you're going to have to
http://twitpic.com/952vl @skimlinks are out punting today
http://twitpic.com/95wtl pimms o'clock
Today I went to Cambridge, rode a punt up the cam to a nice Italian resturant, rode back, came to London and drank pimms. Tired now.
RT @Suw: Well done @openrightsgroup and everyone else who campaigned against Phorm. BT have dropped it. :D http://bit.ly/NJAUn
on the other hand, my data sync system is running faster than it's ever been before.
Yes, it's a very nice directory structure, but it doesn't have any files in it. I kind of need the files that should be in it. Yay monday.
Laughing Yoga. http://bit.ly/zx1ng\n Needs Sound.
@gilmae It's a new specification for whining about first world problems.
Best in life? To obsess over and romanticise your foes, see them get in a taxi you wanted, and to hear their girlfriends enclosed in plastic
@gilmae Radiohead
isn't sure where he got the cover of Creep by The Cure, but is glad he did.
@LupieStardust  I'm around evening and lunchtimeish. Fyr should be around too, but is so far untwittered
#geekscouk http://bit.ly/gAMIH
Trying something out - tweeted from  www.boffer.co.uk
I just got a freebie from www.boffer.co.uk
@catashton You're familier with the concept of Yak Shaving?
Spotify win everything at the #europas except Best entertainment thingy. Which is odd.
Congrats to nimbuzz & @antfox for winning one of the #europas
One small bomb and you could wipe out 80% of the London tech startups. I am snarking from the sofa at the #europas
http://twitpic.com/9tmap the #europas dance floor
@gilmae I Absolutely agree.
LASERS
@LupieStardust Only when they have lasers in it.
is playing with his LASER MEASURING STICK
I am a calm centre of poise and tranquility. Moving house will not disturb this. Yes.
I have a new house!
is tweeting to you from his new flat. Hurrah.
Without my GPS unit, internet device, music player, point+shoot camera, notepad and mobile today. Or, in other words, my iPhone.
Standing in carphone warehouse trying to get my cracked iPhone screen fixed
@dotwaffle somewhere between both. It's my personal server, but it'll be used for hosting other people's stuff, with an eye to breaking even
@
*ahem* bloody international internets. I should have specified colo in the UK, ideally London. Sending the box to USA would be expensive
is looking for reasonable colo hosting for a 2U server. Recommend at me, internets.
@dotwaffle not really. I already have the server :)
If you're going to preorder #windows7 from amazon (it's better than Vista), use http://good.ly/a5hil7 to send a kickback to Crisis
I am in the wrong business. £150 to clean an empty flat, plus £40 for one metre square of carpet?
@Livishort I have that, though it hasn't made it to my work machine yet.
I have five covers of I Will Survive. I have no idea why. Some of them are quite good.
@LupieStardust Personally, I'm spending a day dead for tax raisins
@apiphile ah, the secret conspiracy of Hannah Montana fans that are undermining the morality of our innocent society?
Centos? More like.. something... crappy... Craptos! Yes. Wit, in 140 character form.
is not sure how he managed to miss that @stevenpage is no longer in BNL. Obviously I was dead for february or something.
@LupieStardust Hope to see it toon.
RT @jtopper: Ex-Trutap #followfriday @uminski @alidriver @makk384 @antfox @merixzon @Aquarion @imoan
HAH HA! Take that, Centos. I have beaten you. Hear that? BEATEN YOU.
Swimming in data
@tonywhitmore Disagree, depending on which newsgroups you started with. Some of the ones I was with were really friendly.
@schwuk Wordpress Mu?
@hikari And, in this regard, today is better than a couple of weeks ago.
In "This is not my beautiful life" news, we won the cricket. I knew I'd woken up in the wrong universe this morning, and this proves it.
Amazon's recommending "Time Management for System Administrators" at me. I feel... targeted.
@SJGames Sold. Which game?
@LupieStardust ... you're going to eat Harry Potter? Or you're going to see Meat at the cinema?
I was on Why Don't You...? for a couple of episodes. #lameclaimtofame
@Xalior The internet can go fish.
Is at Maelstrom until Sunday. Yarr piracy.
@ahruman (a) That page hasn't been updated for 6 years and at least 13 releases. (b) New version *still* reports uncompressed sizes wrong.
@theotherelliott Indeed, but the cost of bandwidth doesn't scale the same way, A 4Gb .gz file can be a 40Gb text file,
so, the defacto open source compression format starts lying to you if you compress files > 4Gb. Thanks, gzip. Thzip.
@c_boyle http://bit.ly/frpIQ\n says to try http://good.ly/i5m2rh
And I've fixed the thing that was forkbombing my development environment every time I ran it! Now to make it actually work.
http://bit.ly/ppMAQ BMJ.com: longitudinal cohort study of the displacement of teaspoons in an Australian research institute.
The iPhone should have a "low power mode" switch, which would turn off 3G/Bluetooth/Wifi/Brightness when it'll be a while between recharges.
@delvy and when I can replace my 3G with a 3Gs, I can not only do that, but also drop it into my gold plated swimming pool.
Cricket Fans, you should listen to this song: http://bit.ly/byyFx\n (And buy the album)
I got my iPhone back yesterday. I feel connected again.
RT: @CiaranR Oh look, there's a new home page
@catashton My sympathy, it knows no boundries.
Is slowly coming to the conclusion that @skimhannah may be... hinting, in some subtle way.
@jonobacon I think google sync does it. It certainly did for the N95. It's just a fake Exchange server.
Just changed my twitter background, check it out! Found it at http://www.TwitterBackgrounds.com
@kianryan The dorkest pits of hell.
@kianryan "one more thing"?
@AliciaSkimbit Indeed. Offices should look more like http://bit.ly/b274k
@sil very much so.
Is playing arkham asylum
Today is the 10th System Administrator Appreciation Day. Appreciate your sysadmin. Buy them beer and/or whiskey.
today is 10th Annual
Gotta meet the plane so I can get my monkey, Teach him to be cool but a little bit funky.
@apiphile When life gives you morons, make moron soup. Everyone knows there aren't *any* roads in Devon.
@AliciaSkimbit "Glamping"?
Neat, Champagne and cake for @digijoe's birthday. Especially neat because there are only four @Skimlinks people in the office.
.@clanwilliam I'm assuming that's good, because 263 goals sound like a lot. Or is that over par?
So, Twitter, is being subjected to Britney Spears against some kind of convention?
On the plus side, the Britney went away. On the down side, Beyonce. And now NSync.
RT: @skimhannah Loving the Friday Pop Bonzanza @skimlinks hq - the tween within me is pleased.
@merixzon Multiple language support at once. The others still support single language.
This is a video of a turtle rapeing a shoe. Requires sound. Is the most disturbingly cute thing you'll see today: http://good.ly/yud4qf
True signs your office has too many internet startups in it: Our outgoing IP has been blocked from twitter search.
So, Apparently I can't get house insurance this time because the patio door does not have a key lock. We're on the 17th floor.
@LupieStardust It's fine unless you're a fly, I believe. I assume you're not a fly, since your legs are too long.
via @markofmac, the world's most literal pie chart: http://pics.livejournal.com/tongodeon/pic/000598dc/s640x480
is rapidly coming to the conclusion that he probably should have stayed in bed this morning.
It always amuses me when the Dr Horrible soundtrack comes on while I'm playing City of Villains.
http://bit.ly/eEcKI\n - As My Ukulele Gently Weeps. This is really good.
If you get ill in america, you have to build your own doctor out of buttered toast #alieforalie #welovethenhs
cool, @CiaranR  bought Kinder suprises for the @skimlinks team. I win. \nhttp://twitpic.com/dunuh
@markofmac Kinder Egg Friday beats Trucker Hat Friday.
http://twitpic.com/9tmap - The #Europas dance floor, ~10pm
http://twitpic.com/dunuh - Kinder Suprise Friday at @Skimlinks HQ
@AliciaSkimbit Too Much Information
@palfrey Not seen one yet, but I watched someone playing Bizarre Creation's Blur (Released this Oct) which is wipeouty
@palfrey But keep any eye out for Time Shift next year, which is a racer with deforming racetracks and - somewhat weirdly - time travel.
@palfrey Tracks are more normal - or as I've seen they are - but it's a more mario-karty powerup-based race, which is quite fun
@MrMoth "While the originality and of Mr Willis' inital attempt was well recieved, his latest is just retreading old ground, 2 out of 5"
Just watched Branagh's As You Like It. http://us.imdb.com/title/tt0450972 . It was good.
@MelissaBianco Where there is technology, there is spam :(
Hmm. First attempt at home made hummus: slightly too much salt. Plus, I may have - if this is possible - overdone the garlic
The only reason the world isn't covered with mayonaise right now is because of the acts of five silent heroes. We salute them. #fiction
Amazingly, there's a 40% chance that a tweet today will link to the same BBC news article.
RT @LupieStardust The finest game ever invented: http://www.pornstarorpotato.com/ (nsfw, obviously) (Does not contain actual porn)
Does anyone know of an open source library to do API Key management and stuff?
@jtopper apparently not.
@porangey They're all on Spotify
http://open.spotify.com/track/04Snb8bViXIplbjXYKW9rq
@Xalior Wasn't aware it existed, thanks :)
@tho99 Oh? Why not? Need an invite? :)
@tho99 Oh. I thought it was all europe now. That sucks a lot.
@jtopper Apparently you're too liberal for tomtoms.
@skimhannah It's fine, and will probably be fine right up until rent's due :)
I just scored 129 on Sturgeon Creek in Harbor Master for #iPhone http://itunes.com/app/HarborMaster
@imoan In my defense, it was while I was on the bus to work
@rayyans So I've been told. I'm going to take a look when I'm bored with Harbour Master. Which may be quit soon.
Have you seen www.graze.com ? You can get a free box with my "feed your friends" code: K921MH1T
@stlemur Yeah, but the engineer has solved the Mnt. Dew problem. That's why @TheRaj's being charged money now.
RT: @bigcalm: http://www.todaysbigthing.com/2009/08/20 (via @Xalior)
The world needs "arewewinningthecricket" in .co.uk and .com.au forms
@hikariuk Not the 360 version :)
@MerseyMal Having played the game on 360 and the demo on my PC, I prefer the 360 controls, so I'll be picking it up for that.
I are productive. Finance software updated ("Stop spending money", it says), new coat of paint on table. Now: Games.
Has now completed the new Monkey Island game. Now what?
Xalior Not the new version of the old Monkey Island mode, the *new* Monkey Island games. Though now you mention it, should get that too.
is getting the feeling something crickety just happened.
Right. Today's geekery completed, lastfm and twitter and stuff now hit the front page of aquarionics.com.
As quiet and peaceful as London looks at 04:30, it's probably a bad idea for me to be seeing it again. Sleep.
Slept through alarm, got to office, no water. Going to work from home. Not a wildly successful Monday so far
Hah. After my last tweet I started getting "make thousands from home" spam #ohdofuckoff
@sil where dr pepper is not enough, add vodka
The bits of this morning not spent asleep or on buses have been quite productive. Now on bus into work again.
@Whatleydude's leaving, @Twitter doing premium? today must be "I know we already said this, but this time we're right" day for tech media.
@MitchBeen #BBCPorn is too easy without changing it. Just a minute? The Little and Large Show? Walking with Dinos... no, wait.
@MitchBenn #BBCPorn is too easy without changing it. Just a minute? The Little and Large Show? Walking with Dinos... no, wait.
http://www.boycottscotland.co.uk/
RT: @brokep Press release from The Pirate Bay: http://bit.ly/fzPsk
@theotherelliott I could try, but typography courses are hard to justify.
@simonw Try syslog or /var/log/messages? Either that or check the apache conf files for where they've redirected it?
@sierrakim Jim Butcher is @longshotauthor. Yes, There's a series arc, and it's going to get better :)
@LupieStardust The bit that the Telegraph misses is that the company who was trying to make domestic models of it just went bust
...Rhythmbox's shuffle is developing a somewhat worrying obsession with @MitchBenn.
RT @antfox: "I want to look stupid on one of these soon...  http://bit.ly/2rSTHp"
Spotifying Rolling Stones. Notes the ads are all anti-drug. Also, the "Talk to Frank" campaign has resorted to standard issue scare tactics.
@NeilCrosby Tried QD? Or the weird alcohol shop on Union Street?
In fact, Twitter! Bedford Division! @smin/@jamieo etc. Where can @NeilCrosby buy margarita glasses?
@mikebutcher T-Mobile got their mast up before the NIMBYism kicked in.
@orinoco77 I've been running it as a primary OS for just over a month now, and I'm actually really happy with it.
@LupieStardust Moo.com for business cards. They're ace.
I have got @tweetdeck  running on 64 bit ubuntu. Kinda. It's running on a 32 bit laptop and exporting the output over ssh to the 64 bit box.
Fun with Spotify under Wine: Clicking on the non-clickable bits makes the window jump one screen to the left, wrapping over virtual desktops
@popey woulld you prefer everyone put dancing ads in instead? Aff. Links work best when people click because they trust the recommendation.
@popey Yeah, I agree with that. links like that tend not to work as well from a monitisation pov anyway. Actual recomendations for everyone
@popey (That should be "work better for everyone")
today is Documentation Day on planet Aquarion. Sitting at home are the boxes containing my new computer. Six point three hours remaining.
Heading home to put my new computer together. #LegendaryFridayNight
@LupieStardust I love that I could tell where you've been just that. Have a MEDL. It's like a medal, but you'll need a hex key to put it on.
is regretting starting his day by reading comments on @paulcarr's @TechCrunch article. A fine argument against freedom of expression.
bad things to read when you live on the 17th floor: "Lift out of order"
Coding custom plugins and themes for Aquarionics.com. Bringing back the banners system.
@kianryan and if you get bored with that, the Rolling Stone top 500 is http://open.spotify.com/user/kieron/playlist/5Rrf7mqN8uus2AaQQQNdc1
This song is funny, and NSFW, and new, and by @PaulAndStorm: http://www.nuggetman.com/songs/newstuff/IWillSingaLullabye.mp3